PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 363aa    MW: 39610 Da    PI: 7.0133
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042211genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.21e-09184232553
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Lus10042211 184 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLFQ 232
                  9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-15180244IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542182245IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-8184238No hitNo description
SuperFamilySSF579593.31E-10184235No hitNo description
PfamPF001701.8E-8184232IPR004827Basic-leucine zipper domain
CDDcd147032.12E-23185234No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MDAHDPIPKP NPNAAPSSSN NHHPPPRPSP AALLSAANSN SSSFVNARPF APPHGGHHHR  60
RALSETNFRF PDDMAKMMMM DLSPSDPMAS VGGGSSTCSQ EEIGSEDDLF STYIDVDKLT  120
GGAGNCADQS NGVNRNSGEK SSRPATKHRH SNSVDGSAAF GEIMDAKKAM PPEKLAELWN  180
LDPKRAKRIL ANRQSAARSK ERKARYILEL ERKVQTLQTE ATTLSAQLTL FQRDTTGLST  240
ENTELKLRLQ AMEQQAQLRD ALNEALKKEL EKLKVATGEP ISPSESFNFG MHQFPFTPSN  300
MFSHPQQAMP SQNMHQTNNH QLSDAMQNES LARFQGLDIS SKGQQSLVKS EEYSISASET  360
SS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017082.11e-145Basic-leucine zipper transcription factor family protein
SwissprotQ6S4P49e-93RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061GYW11e-145A0A061GYW1_THECC; Basic-leucine zipper transcription factor family protein
STRINGGLYMA18G05880.21e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.15e-80bZIP family protein